PDB entry 2ebj

View 2ebj on RCSB PDB site
Description: Crystal structure of pyrrolidone carboxyl peptidase from Thermus thermophilus
Class: hydrolase
Keywords: pyrrolidone carboxyl peptidase, Thermus thermophilus, TTHA0888, degradation of proteins and peptides, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2007-02-08, released 2007-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.228
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0888
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebja_
  • Chain 'B':
    Compound: pyrrolidone carboxyl peptidase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: TTHA0888
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ebjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ebjA (A:)
milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpka
vlhlglaedrpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlar
wreagipgrpslsagsylcnqafylslyrlpeevpvgflhlppdetlalkrprpyvplev
qaravrlalehl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ebjB (B:)
milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpka
vlhlglaedrpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlar
wreagipgrpslsagsylcnqafylslyrlpeevpvgflhlppdetlalkrprpyvplev
qaravrlalehl