PDB entry 2eao

View 2eao on RCSB PDB site
Description: Solution structure of the C-terminal SAM-domain of mouse ephrin type-B receptor 1 precursor (EC 2.7.1.112)
Class: signaling protein, transferase
Keywords: CELL-FREE PROTEIN SYNTHESIS, PROTEIN REGULATION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2007-01-31, released 2007-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB1, EPHT2, NET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54762 (7-92)
      • cloning artifact (0-6)
      • cloning artifact (93-98)
    Domains in SCOPe 2.08: d2eaoa1, d2eaoa2, d2eaoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2eaoA (A:)
    gssgssgsqplldrsipdftafttvddwlsaikmvqyrdsfltagftslqlvtqmtsedl
    lrigitlaghqkkilnsihsmrvqisqsptamasgpssg