PDB entry 2e1o

View 2e1o on RCSB PDB site
Description: Solution structure of RSGI RUH-028, a homeobox domain from human cDNA
Class: structural genomics, unknown function
Keywords: DNA binding protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-10-27, released 2006-11-14
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein PRH
    Species: Homo sapiens [TaxId:9606]
    Gene: HHEX, HEX, PRH, PRHX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03014 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.02: d2e1oa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e1oA (A:)
    gssgssgkggqvrfsndqtielekkfetqkylspperkrlakmlqlserqvktwfqnrra
    kwrrsgpssg