PDB entry 2dny

View 2dny on RCSB PDB site
Description: Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-04-27, released 2007-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fuse-binding protein-interacting repressor, isoform b
    Species: Homo sapiens [TaxId:9606]
    Gene: SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • GB AAH08875 (7-112)
      • cloning artifact (0-6)
      • cloning artifact (113-118)
    Domains in SCOPe 2.06: d2dnya1, d2dnya2, d2dnya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dnyA (A:)
gssgssgkllrkqestvmvlrnmvdpkdidddlegevteecgkfgavnrviiyqekqgee
edaeiivkifvefsiasethkaiqalngrwfagrkvvaevydqerfdnsdlsasgpssg