PDB entry 2dno

View 2dno on RCSB PDB site
Description: Solution structure of RNA binding domain in Trinucleotide repeat containing 4 variant
Class: RNA binding protein
Keywords: RRM domain, RBD, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trinucleotide repeat containing 4 variant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SZQ7 (7-95)
      • cloning artifact (0-6)
      • cloning artifact (96-101)
    Domains in SCOPe 2.05: d2dnoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dnoA (A:)
gssgssgsrgedrklfvgmlgkqqtdedvrkmfepfgtidectvlrgpdgtskgcafvkf
qthaeaqaaintlhssrtlpgassslvvkfadtekesgpssg