PDB entry 2dmz

View 2dmz on RCSB PDB site
Description: Solution structure of the third PDZ domain of human InaD-like protein
Class: protein binding
Keywords: PDZ domain, InaD-like protein, Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: InaD-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: INADL, PATJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NI35 (7-122)
      • cloning artifact (0-6)
      • engineered (52)
      • cloning artifact (123-128)
    Domains in SCOPe 2.05: d2dmza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dmzA (A:)
    gssgssggsdsslfetynvelvrkdgqslgirivgyvgtshtgeasgiyvksvipgsaay
    hnghiqvndkivavdgvniqgfanhdvvevlrnagqvvhltlvrrktssstspleppsdr
    gtvsgpssg