PDB entry 2dmg

View 2dmg on RCSB PDB site
Description: Solution structure of the third C2 domain of KIAA1228 protein
Class: lipid binding protein
Keywords: beta-sandwich, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIPID BINDING PROTEIN
Deposited on 2006-04-21, released 2006-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA1228 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1228
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6UKI4 (7-135)
    • cloning artifact (0-6)
    • cloning artifact (136-141)
  Domains in SCOPe 2.06: d2dmga1, d2dmga2, d2dmga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmgA (A:)
  gssgssgsplgqiqltirhssqrnklivvvhacrnliafsedgsdpyvrmyllpdkrrsg
  rrkthvskktlnpvfdqsfdfsvslpevqrrtldvavknsggflskdkgllgkvlvalas
  eelakgwtqwydltedsgpssg