PDB entry 2dmf

View 2dmf on RCSB PDB site
Description: An extended conformation of the RWD domain of human Ring finger protein 25
Class: ligase
Keywords: Ligase, Metal-binding, Ub1 conjugation, Ub1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-21, released 2006-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RING finger protein 25
  Species: Homo sapiens [TaxId:9606]
  Gene: RNF25
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96BH1 (7-130)
    • cloning artifact (0-6)
    • cloning artifact (131-136)
  Domains in SCOPe 2.08: d2dmfa1, d2dmfa2, d2dmfa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmfA (A:)
  gssgssgeedwvlpsevevlesiyldelqvikgngrtspweiyitlhpataedqdsqyvc
  ftlvlqvpaeyphevpqisirnprglsdeqihtilqvlghvakaglgtamlyeliekgke
  iltdnniphgqsgpssg