PDB entry 2dl2

View 2dl2 on RCSB PDB site
Description: killer immunoglobulin receptor 2dl2
Class: immune system
Keywords: kir, natural killer receptor, inhibitory receptor, 2dl2, immunoglobulin, immune system
Deposited on 1999-03-08, released 1999-03-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (MHC class I nk cell receptor precursor (p58 natural killer cell receptor clone cl-43))
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2dl2a1, d2dl2a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dl2A (A:)
ahrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlages
vtlscssrssydmyhlsregeahecrfsagpkvngtfqadfplgpathggtyrcfgsfrd
spyewsnssdpllvsvi