PDB entry 2db5

View 2db5 on RCSB PDB site
Description: Solution structure of the first PDZ domain of InaD-like protein
Class: protein binding
Keywords: PDZ domain, InaD-like protein,Inadl protein, hINADL, Pals1-associated tight junction protein, Protein associated to tight junctions, INADL, PATJ, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-12-15, released 2006-06-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: InaD-like protein
    Species: Homo sapiens [TaxId:9606]
    Gene: INADL, PATJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NI35 (7-121)
      • cloning artifact (0-6)
      • cloning artifact (122-127)
    Domains in SCOPe 2.05: d2db5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2db5A (A:)
    gssgssglgnedfnsviqqmaqgrqieyidierpstgglgfsvvalrsqnlgkvdifvkd
    vqpgsvadrdqrlkendqilainhtpldqnishqqaiallqqttgslrlivarepvhtks
    stsgpssg