PDB entry 2d7n

View 2d7n on RCSB PDB site
Description: Solution structure of the 16th Filamin domain from human Filamin C
Class: structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2005-11-24, released 2006-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14315 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.08: d2d7na1, d2d7na2, d2d7na3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d7nA (A:)
    gssgssglrpfnlvipfavqkgeltgevrmpsgktarpnitdnkdgtitvryaptekglh
    qmgikydgnhipgsplqfyvdainsrhsgpssg