PDB entry 2cuj

View 2cuj on RCSB PDB site
Description: Solution structure of SWIRM domain of mouse transcriptional adaptor 2-like
Class: transcription
Keywords: Transcriptional regulation, Nuclear protein, ADA2, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-05-26, released 2005-11-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional adaptor 2-like
  Species: Mus musculus [TaxId:10090]
  Gene: Tada2l
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8BNK0 (7-107)
    • cloning artifact (0-6)
  Domains in SCOPe 2.01: d2cuja1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cujA (A:)
  gssgssgidsglspsvlmasnsgrrsapplnltglpgteklnekekelcqvvrlvpgayl
  eyksallnechkqgglrlaqaralikidvnktrkiydfliregyitka