PDB entry 2cu8

View 2cu8 on RCSB PDB site
Description: Solution structure of the LIM domain of human Cysteine-rich protein 2
Class: metal binding protein
Keywords: CRP2, CRIP2, ESP1 protein, zinc-binding, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-25, released 2005-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine-rich protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRIP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52943 (7-69)
      • cloning artifact (0-6)
      • cloning artifact (70-75)
    Domains in SCOPe 2.05: d2cu8a1, d2cu8a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cu8A (A:)
gssgssgmaskcpkcdktvyfaekvsslgkdwhkfclkcercsktltpgghaehdgkpfc
hkpcyatlfgsgpssg