PDB entry 2ctx

View 2ctx on RCSB PDB site
Description: the refined crystal structure of alpha-cobratoxin from naja naja siamensis at 2.4-angstroms resolution
Class: neurotoxin
Keywords: neurotoxin
Deposited on 1991-09-24, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-cobratoxin
  Species: Naja naja [TaxId:35670]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25671 (0-70)
  Domains in SCOPe 2.05: d2ctxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ctxA (A:)
  ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
  ncnpfptrkrp