PDB entry 2crp

View 2crp on RCSB PDB site
Description: Solution structure of the RGS domain of regulator of G-protein signalling 5 (RGS 5)
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signaling 5, RGS5, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, signaling protein
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 5
  Species: Homo sapiens [TaxId:9606]
  Gene: RGS5
  Database cross-references and differences (RAF-indexed):
  • Uniprot O15539 (7-143)
    • cloning artifact (0-6)
    • cloning artifact (144-149)
  Domains in SCOPe 2.05: d2crpa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2crpA (A:)
  gssgssgpekpaktqktsldealqwrdsldkllqnnyglasfksflksefseenlefwia
  cedykkikspakmaekakqiyeefiqteapkevnidhftkditmknlvepslssfdmaqk
  rihalmekdslprfvrsefyqelisgpssg