PDB entry 2cdt

View 2cdt on RCSB PDB site
Description: alpha-spectrin sh3 domain a56s mutant
Class: structural protein
Keywords: sh3-domain, cytoskeleton, calmodulin-binding, actin-binding, structural protein
Deposited on 2006-01-27, released 2007-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spectrin alpha chain
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDT
      • engineered mutation (55)
    • Uniprot P07751 (Start-61)
    Domains in SCOPe 2.07: d2cdta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cdtA (A:)
    mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkk
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cdtA (A:)
    kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpasyvkkld