PDB entry 2cc1

View 2cc1 on RCSB PDB site
Description: crystal structure of the class a beta-lactamase from mycobacterium fortuitum
Class: hydrolase
Keywords: hydrolase, antibiotic resistance, beta-lactamase, broad-spectrum, penicillin
Deposited on 2006-01-11, released 2006-01-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: MYCOBACTERIUM FORTUITUM, synthetic [TaxId:1766]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59517 (222-261)
      • conflict (34)
      • conflict (48)
      • conflict (155)
    Domains in SCOPe 2.01: d2cc1a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cc1A (A:)
    apiddqlaelerrdnvliglyaanlqsgrrithrpdemfamcstfkgyvaarvlqmaehg
    eisldnrvfvdadalvpnspvtearagaemtlaelcqaalqrsdntaanlllktiggpaa
    vtafarsvgdertrldrwevelnsaipgdprdtstpaalavgyrailagdalsppqrgll
    edwmranqtssmraglpegwttadktgsgdygstndagiafgpdgqrlllvmmtrsqahd
    pkaenlrpligeltalvlpsll