PDB entry 2bep

View 2bep on RCSB PDB site
Description: crystal structure of ubiquitin conjugating enzyme e2-25k
Class: ligase
Keywords: ligase, ubiquitin, e2 conjugating enzyme, protein degradation, structural proteomics in europe, spine, structural genomics
Deposited on 2004-11-29, released 2005-02-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.169
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2-25 kDa
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BEP (Start-3)
    • Uniprot P61085 (4-158)
    Domains in SCOPe 2.01: d2bepa1
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bepA (A:)
    gamamaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggry
    qleikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqal
    laaaepddpqdavvanqykqnpemfkqtarlwahvyaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bepA (A:)
    amaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqle
    ikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaa
    aepddpqdavvanqykqnpemfkqtarlwahvyaga