PDB entry 2b8m

View 2b8m on RCSB PDB site
Description: Crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, unknown function
Deposited on 2005-10-07, released 2005-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.152
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein MJ0764
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: 1499583
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q58174 (1-End)
    • leader sequence (0)
    • modified residue (1)
    • modified residue (39)
    • modified residue (57)
    • modified residue (83)
  Domains in SCOPe 2.06: d2b8ma1, d2b8ma2
• Heterogens: SO4, CL, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2b8mA (A:)
  gmiekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtl
  tledqephnykegnivyvpfnvkmliqninsdileffvvkaphpkklnapedpikce
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2b8mA (A:)
  gmiekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtl
  tledqephnykegnivyvpfnvkmliqninsdileffvvkaphpkklna