PDB entry 2b0g

View 2b0g on RCSB PDB site
Description: Solution Structure of Drosophila melanogaster SNF RBD2
Class: RNA binding protein
Keywords: SNF RBD2,RNA binding, RNA splicing, solution structure, RNA BINDING PROTEIN
Deposited on 2005-09-14, released 2006-12-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: U1 small nuclear ribonucleoprotein A
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b0ga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b0gA (A:)
    aqteqppnqilfltnlpeetnemmlsmlfnqfpgfkevrlvpnrhdiafvefttelqsna
    akealqgfkitpthamkitfakk