PDB entry 2avs

View 2avs on RCSB PDB site
Description: kinetics, stability, and structural changes in high resolution crystal structures of HIV-1 protease with drug resistant mutations L24I, I50V, and G73S
Class: hydrolase
Keywords: drug resistance, hiv-1 protease,indinavir, substrate analog,non-active site mutants., hydrolase
Deposited on 2005-08-30, released 2006-01-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.109
AEROSPACI score: 0.95 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (49)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.01: d2avsa_
• Chain 'B':
  Compound: Pol polyprotein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04587 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (49)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.01: d2avsb_
• Heterogens: PO4, SO4, DMS, MK1, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2avsA (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2avsB (B:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggvggfikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf