PDB entry 2aid

View 2aid on RCSB PDB site
Description: structure of a non-peptide inhibitor complexed with hiv-1 protease: developing a cycle of structure-based drug design
Class: aspartyl protease
Keywords: aspartyl protease, hiv, non-peptide inhibitor, drug design
Deposited on 1997-04-17, released 1997-10-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: human immunodeficiency virus protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.01: d2aida_
• Chain 'B':
  Compound: human immunodeficiency virus protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered (6)
  Domains in SCOPe 2.01: d2aidb_
• Heterogens: CL, THK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aidA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2aidB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgptpvniigrnlltqigctlnf