PDB entry 2afp

View 2afp on RCSB PDB site
Description: the solution structure of type II antifreeze protein reveals a new member of the lectin family
Class: antifreeze protein
Keywords: recombinant sea raven protein, solution backbone fold, c-type lectin, antifreeze protein
Deposited on 1998-12-14, released 1998-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (sea raven type II antifreeze protein)
    Species: Hemitripterus americanus [TaxId:8094]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2afpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2afpA (A:)
qragpncpagwqplgdrciyyettamtwalaetncmklgghlasihsqeehsfiqtlnag
vvwiggsaclqagawtwsdgtpmnfrswcstkpddvlaaccmqmtaaadqcwddlpcpas
hksvcamtf