PDB entry 2a9o

View 2a9o on RCSB PDB site
Description: Crystal structures of an activated YycF homologue, the essential response regulator from S.pneumoniae in complex with BeF3 and the effect of pH on BeF3 binding, possible phosphate in the active site
Class: signaling protein
Keywords: Response Regulator, Essential Protein, YycF/YycG Homolog, S.pneumoniae, SIGNALING PROTEIN
Deposited on 2005-07-12, released 2006-09-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.195
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Response regulator
  Species: Streptococcus pneumoniae [TaxId:1313]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9S1K0
  Domains in SCOPe 2.06: d2a9oa_
• Heterogens: MN, BEF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2a9oA (A:)
  mkkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidg
  levaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrrsq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2a9oA (A:)
  kkilivddekpisdiikfnmtkegyevvtafngrealeqfeaeqpdiiildlmlpeidgl
  evaktirktssvpilmlsakdsefdkviglelgaddyvtkpfsnrelqarvkallrr