PDB entry 2a2v

View 2a2v on RCSB PDB site
Description: The solution structure of Jingzhaotoxin-XI
Class: toxin
Keywords: ICK motif, neurotoxin spider
Deposited on 2005-06-23, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Jingzhaotoxin-XI
    Species: Chilobrachys jingzhao [TaxId:278060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2a2va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2a2vA (A:)
    ecrkmfggcsvdsdccahlgckptlkycawdgtf