PDB entry 1zn0

View 1zn0 on RCSB PDB site
Description: Coordinates of RRF and EF-G fitted into Cryo-EM map of the 50S subunit bound with both EF-G (GDPNP) and RRF
Class: translation/biosynthetic protein/RNA
Keywords: ribosome recycling factor, elongation factor G, 50S subunit, TRANSLATION/BIOSYNTHETIC PROTEIN/RNA COMPLEX
Deposited on 2005-05-11, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-02-02, with a file datestamp of 2010-01-29.
Experiment type: EM
Resolution: 15.5 Å
R-factor: N/A
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1zn0a1
  • Chain 'B':
    Compound: Elongation factor G
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1ZN0 (0-654)
  • Chain 'C':
    Compound: 16S ribosomal RNA
    Species: Escherichia coli [TaxId:562]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zn0A (A:)
misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
aeqarvavrnvrrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
elmqf

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.