PDB entry 1zj7

View 1zj7 on RCSB PDB site
Description: Crystal structure of a complex of mutant HIV-1 protease (A71V, V82T, I84V) with a hydroxyethylamine peptidomimetic inhibitor BOC-PHE-PSI[S-CH(OH)CH2NH]-PHE-GLU-PHE-NH2
Class: hydrolase/hydrolase inhibitor
Keywords: hiv, protease, peptidomimetic inhibitor, hydrolase-hydrolase inhibitor complex
Deposited on 2005-04-28, released 2006-05-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.229
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (70)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.01: d1zj7a_
  • Heterogens: 0ZT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1zj7A (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkvigtvlvgptptnvigrnlltqigctlnf