PDB entry 1z6m

View 1z6m on RCSB PDB site
Description: Structure of Conserved Protein of Unknown Function from Enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, structural genomics, MCSG,, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2005-03-22, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.157
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q837R1 (3-174)
      • cloning artifact (0-2)
    Domains in SCOPe 2.06: d1z6ma1, d1z6ma2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6mA (A:)
    snamdisvidatkvntetglhigesnapvkmiefinvrcpycrkwfeeseellaqsvksg
    kveriiklfdkekeslqrgnvmhhyidysapeqalsalhkmfatqdewgnltleevatya
    eknlglkeqkdatlvsaviaeanaahiqfvptiiigeyifdesvteeelrgyiek