PDB entry 1z66

View 1z66 on RCSB PDB site
Description: NMR solution structure of domain III of E-protein of tick-borne Langat flavivirus (no RDC restraints)
Class: viral protein
Keywords: Viral Protein
Deposited on 2005-03-21, released 2006-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major envelope protein E
    Species: Langat virus [TaxId:11085]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1z66a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1z66A (A:)
    kgltytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlit
    pnptmenngggfiemqlppgdniiyvgdlnhqwfqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1z66A (A:)
    tytvcdktkftwkraptdsghdtvvmevgfsgtrpcripvravahgvpevnvamlitpnp
    tmenngggfiemqlppgdniiyvgdlnhqwfqk