PDB entry 1z3q

View 1z3q on RCSB PDB site
Description: Resolution of the structure of the allergenic and antifungal banana fruit thaumatin-like protein at 1.7A
Class: antifungal protein
Keywords: beta sandwich, ANTIFUNGAL PROTEIN
Deposited on 2005-03-14, released 2006-01-24
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.144
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thaumatin-like protein
  Species: Musa acuminata [TaxId:4641]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O22322 (0-166)
  Domains in SCOPe 2.02: d1z3qa_
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z3qA (A:)
  atfeivnrcsytvwaaavpgggrqlnqgqswtinvnagttggriwgrtgcsfdgsgrgrc
  qtgdcggvlsctaygnppntlaefalnqfnnldffdislvdgfnvpmdfsptsggcrgir
  caadingqcpgalkapggcnnpctvfktdqyccnsgacsptdysqffkrncpdaysypkd
  dqtttftcpggtnyrvvfcp