PDB entry 1ywa

View 1ywa on RCSB PDB site
Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with CO at pH 5.6
Class: ligand binding protein, blood clotting
Keywords: ferrous heme; carbon monoxide complex; lipocalin fold; beta barrel, LIGAND BINDING PROTEIN, BLOOD CLOTTING
Deposited on 2005-02-17, released 2005-10-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.89 Å
R-factor: 0.121
AEROSPACI score: 1.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ywaa_
  • Heterogens: PO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ywaA (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk