PDB entry 1yv7

View 1yv7 on RCSB PDB site
Description: X-ray structure of (C87S,des103-104) onconase
Class: hydrolase
Keywords: small conformational changes, onconase thermal stability, ribonucleases, antitumor action, dynamics, HYDROLASE
Deposited on 2005-02-15, released 2005-03-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: P-30 protein
  Species: Rana pipiens [TaxId:8404]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22069 (0-101)
    • engineered (86)
  Domains in SCOPe 2.08: d1yv7a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yv7A (A:)
  edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
  sefylsdcnvtsrpckyklkkstnkfsvtcenqapvhfvgvg