PDB entry 1yse

View 1yse on RCSB PDB site
Description: Solution structure of the MAR-binding domain of SATB1
Class: DNA binding protein
Keywords: all helical, DNA-binding domain, T-cell development, DNA BINDING PROTEIN
Deposited on 2005-02-08, released 2006-01-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein SATB1
    Species: Homo sapiens [TaxId:9606]
    Gene: SATB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ysea1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yseA (A:)
gshvsrsmnkpleqqvstntevsseiyqwvrdelkragisqavfarvafnrtqgllseil
rkeedpktasqsllvnlramqnflqlpeaerdriyqdererslnaasamgpaplistpps
rppqvktatiaterngkpenn

    Sequence, based on observed residues (ATOM records): (download) 
    >1yseA (A:)
ntevsseiyqwvrdelkragisqavfarvafnrtqgllseilrkeedpktasqsllvnlr
amqnflqlpeaerdriyqdererslnaa