PDB entry 1y4l

View 1y4l on RCSB PDB site
Description: Crystal structure of Bothrops asper myotoxin II complexed with the anti-trypanosomal drug suramin
Class: hydrolase
Keywords: Bothrops asper myotoxin II, anti-trypanosomal drug suramin, HYDROLASE
Deposited on 2004-12-01, released 2005-06-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1y4la_
  • Chain 'B':
    Compound: Phospholipase A2 homolog 2
    Species: Bothrops asper [TaxId:8722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1y4lb_
  • Heterogens: SVR, P33, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y4lA (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1y4lB (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennsclkelcecdkavaiclrenlntynkkyryylkplckkada
c