PDB entry 1xsx

View 1xsx on RCSB PDB site
Description: NMR Structure of Sso10a, a Hyperthermophile DNA-binding Protein with an Extended Anti-parallel Coiled Coil
Class: DNA binding protein
Keywords: winged helix-turn-helix, anti-parallel coiled coil dimer, hyperthermophile DNA-binding protein, DNA BINDING PROTEIN
Deposited on 2004-10-20, released 2005-03-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sso10a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: Sso10a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xsxa1
  • Chain 'B':
    Compound: Sso10a
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: Sso10a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1xsxb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xsxA (A:)
    akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
    kkgeelledirkfnemrknmdqlkekinsvlsirq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xsxB (B:)
    akkkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymlt
    kkgeelledirkfnemrknmdqlkekinsvlsirq