PDB entry 1xjc

View 1xjc on RCSB PDB site
Description: X-ray crystal structure of MobB protein homolog from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: structural genomics, MobB, Midwest Center for Structural Genomics, PSI, Protein Structure Initiative, MCSG, unknown function
Deposited on 2004-09-23, released 2004-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MobB protein homolog
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP0958
    Database cross-references and differences (RAF-indexed):
    • PDB 1XJC
    Domains in SCOPe 2.06: d1xjca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xjcA (A:)
    snamnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhghggeparpegvdsvrher
    agavatavegdgllqlhlrrplwrlddvlalyaplrldlvlvegykqerhpkvvlvrsee
    dwaslqhlaniraviaweplegplahpvfsladddeyipwlmnevrtrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xjcA (A:)
    mnvwqvvgykhsgkttlmekwvaaavregwrvgtvkhhgavatavegdgllqlhlrrplw
    rlddvlalyaplrldlvlvegykqerhpkvvlvrseedwaslqhlaniraviaweplegp
    lahpvfsladddeyipwlmnevrtr