PDB entry 1x8s

View 1x8s on RCSB PDB site
Description: Structure of the Par-6 PDZ domain with a Pals1 internal ligand
Class: cell cycle
Keywords: cell cycle, par-6
Deposited on 2004-08-18, released 2004-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg5884-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Par-6
    Database cross-references and differences (RAF-indexed):
    • GB NP_573238 (2-End)
    Domains in SCOPe 2.06: d1x8sa_
  • Chain 'B':
    Compound: Pals1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1X8S (Start-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1x8sA (A:)
gsethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestglla
vndevievngievagktldqvtdmmvanssnliitvkpanqr

    Sequence, based on observed residues (ATOM records): (download) 
    >1x8sA (A:)
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpan

  • Chain 'B':
    No sequence available.