PDB entry 1x4c

View 1x4c on RCSB PDB site
Description: Solution structure of RRM domain in splicing factor 2
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM domain, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2005-05-14, released 2005-11-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Splicing factor, arginine/serine-rich 1
  Species: Mus musculus [TaxId:10090]
  Gene: Sfrs1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6PDM2 (7-101)
    • cloning artifact (0-6)
    • cloning artifact (102-107)
  Domains in SCOPe 2.01: d1x4ca1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x4cA (A:)
  gssgssggppsrrsenrvvvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrk
  edmtyavrkldntkfrshegetayirvkvdgprspsygrsrssgpssg