PDB entry 1x44

View 1x44 on RCSB PDB site
Description: Solution structure of the third ig-like domain of Myosin-dinding protein C, slow-type
Class: contractile protein
Keywords: IG-like domain, Myosin-binding protein C, slow-type/Skeletal muscle slow-isoform, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2005-05-13, released 2005-11-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myosin-binding protein C, slow-type
  Species: Homo sapiens [TaxId:9606]
  Gene: MYBPC1, MYBPCS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00872 (7-96)
    • cloning artifact (0-6)
    • cloning artifact (97-102)
  Domains in SCOPe 2.05: d1x44a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x44A (A:)
  gssgssgimvtkqledttaycgervelecevseddanvkwfkngeeiipgpksryrirve
  gkkhiliiegatkadaaeysvmttggqssaklsvdlksgpssg