PDB entry 1x2q

View 1x2q on RCSB PDB site
Description: Solution structure of the SH3 domain of the Signal transducing adaptor molecule 2
Class: signaling protein
Keywords: SH3 domain, Signal transducing adaptor molecule, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Signal transducing adapter molecule 2
  Species: Homo sapiens [TaxId:9606]
  Gene: STAM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75886 (7-81)
    • cloning artifact (0-6)
    • cloning artifact (82-87)
  Domains in SCOPe 2.05: d1x2qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1x2qA (A:)
  gssgssgseiqlnnkvarkvralydfeavedneltfkhgeiiivlddsdanwwkgenhrg
  iglfpsnfvttnlnieteaaavsgpssg