PDB entry 1wjx

View 1wjx on RCSB PDB site
Description: Crystal sturucture of TT0801 from Thermus thermophilus
Class: RNA Binding Protein
Keywords: RNA binding protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-05-29, released 2004-11-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2008-10-21, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.224
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SsrA-binding protein
    Species: Thermus thermophilus [TaxId:274]
    Gene: TT0801
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1wjxa_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wjxA (A:)
    apvlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyia
    pyekgsyanvdprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglar
    gk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wjxA (A:)
    vlenrrarhdyeiletyeagialkgtevkslragkvdftgsfarfedgelylenlyiapv
    dprrkrklllhkhelrrllgkveqkgltlvplkiyfnergyakvllglargk