PDB entry 1wgp

View 1wgp on RCSB PDB site
Description: Solution structure of the cNMP-binding domain from Arabidopsis thaliana cyclic nucleotide-regulated ion channel
Class: membrane protein
Keywords: cyclic nucleotide monophosphate, cNMP, cNMP-binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2004-05-28, released 2004-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable cyclic nucleotide-gated ion channel 6
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: RIKEN RAFL05-10-A11
  Database cross-references and differences (RAF-indexed):
  • Uniprot O82226 (7-130)
    • cloning artifact (0-6)
    • cloning artifact (131-136)
  Domains in SCOPe 2.06: d1wgpa1, d1wgpa2, d1wgpa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wgpA (A:)
  gssgssgvrrvplfenmderlldaicerlkpclfteksylvregdpvnemlfiirgrles
  vttdggrsgfynrsllkegdfcgdelltwaldpksgsnlpsstrtvkalteveafaliad
  elkfvasqfrrsgpssg