PDB entry 1uzq

View 1uzq on RCSB PDB site
Description: Integrin binding cbEGF22-TB4-cbEGF33 fragment of human fibrillin-1, apo form cbEGF23 domain only.
Class: matrix protein
Keywords: matrix protein, extra-cellular matrix, fibrillin-1, cbegf domain, tb domain matrix protein
Deposited on 2004-03-15, released 2004-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibrillin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uzqa1, d1uzqa2, d1uzqa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1uzqA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldirprgdng
dtacsneigvgvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitvile
didecqelpglcqggkcintfgsfqcrcptgyylnedtrvcd

    Sequence, based on observed residues (ATOM records): (download) 
    >1uzqA (A:)
tdvnecldpttcisgncvntpgsyicdcppdfelnptrvgcvdtrsgncyldicsneigv
gvskascccslgkawgtpcemcpavntseykilcpggegfrpnpitviledidecqelpg
lcqggkcintfgsfqcrcptgyylnedtrvcd