PDB entry 1ug4

View 1ug4 on RCSB PDB site
Description: Crystal Structure of Cardiotoxin VI from Taiwan Cobra (Naja atra) Venom
Class: toxin
Keywords: cardiotoxin, cobra, venom
Deposited on 2003-06-12, released 2005-02-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.239
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytotoxin 6
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ug4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ug4A (A:)
    lkcnqlippfyktcaagknlcykmfmvaapkvpvkrgcidvcpkssllvkyvccntdrcn