PDB entry 1uen

View 1uen on RCSB PDB site
Description: Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
Class: cell adhesion
Keywords: Immunoglobulin-like Beta-Sandwich Fold, Fibronectin Type III, NG-CAM Related Cell Adhesion Molecule, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-05-19, released 2003-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0343 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KAZUSA cDNA hg01457
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92823 (7-118)
    • cloning artifact (0-6)
    • cloning artifact (119-124)
  Domains in SCOPe 2.06: d1uena1, d1uena2, d1uena3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uenA (A:)
  gssgssghsgedlpmvapgnvrvnvvnstlaevhwdpvplksirghlqgyriyywktqss
  skrnrrhiekkiltfqgskthgmlpglepfshytlnvrvvngkgegpaspdrvfntpegs
  gpssg