PDB entry 1u73

View 1u73 on RCSB PDB site
Description: Crystal structure of a Dimeric Acidic Platelet Aggregation Inhibitor and Hypotensive Phospholipase A2 from Bothrops jararacussu
Class: hydrolase
Keywords: X-ray crystallography, acidic phospholipase A2, Bothrops jararacussu venom, platelet aggregation and hypotensive effects, crystal structure, oligomeric state, dimeric, hydrolase
Deposited on 2004-08-02, released 2004-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypotensive phospholipase A2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1u73a_
  • Chain 'B':
    Compound: hypotensive phospholipase A2
    Species: Bothrops jararacussu [TaxId:8726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1u73b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u73A (A:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
    idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u73B (B:)
    slwqfgkminyvmgesgvlqylsygcycglggqgqptdatdrccfvhdccygkvtgcdpk
    idsytyskkngdvvcggddpckkqicecdrvattcfrdnkdtydikywfygakncqekse
    pc