PDB entry 1u5s

View 1u5s on RCSB PDB site
Description: NMR structure of the complex between Nck-2 SH3 domain and PINCH-1 LIM4 domain
Class: metal binding protein
Keywords: Protein-protein complex, beta barrel, beta sheet, zinc finger, METAL BINDING PROTEIN
Deposited on 2004-07-28, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic protein NCK2
    Species: Homo sapiens [TaxId:9606]
    Gene: NCK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u5sa1
  • Chain 'B':
    Compound: PINCH protein
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48059 (2-65)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1u5sb1, d1u5sb2, d1u5sb3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u5sA (A:)
qgsrvlhvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpkny
vvvlsdgpalh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u5sB (B:)
gsmgvpicgacrrpiegrvvnamgkqwhvehfvcakcekpflghrhyerkglaycethyn
qlfgdv