PDB entry 1u3j
View 1u3j on RCSB PDB site
Description: Crystal stucture of MLAV mutant of dimerisation domain of NF-kB p50 transcription factor
Class: transcription
Keywords: transcription factor; nf-kb; dimerization domain; intertwined folding
Deposited on
2004-07-22, released
2004-08-17
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.49
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Nuclear factor NF-kappa-B p105 subunit
Species: Mus musculus [TaxId:10090]
Gene: Nfkb1, 18033
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d1u3ja_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1u3jA (A:)
asnlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
Sequence, based on observed residues (ATOM records): (download)
>1u3jA (A:)
nlkivrmdrtagcvtggeeimllcdkvqkddiqirfyeevwegfgdfsptdvhrqfaivf
ktpkykdvnitkpasvfvqlrrksdletsepkpflyype