PDB entry 1u2h

View 1u2h on RCSB PDB site
Description: X-ray Structure of the N-terminally truncated human APEP-1
Class: contractile protein
Keywords: Structural Genomics, Ig-fold I-set, RGD motif, Homophilic Adhesion, Arterial Smooth Muscle Cells, Atherosclerosis, CONTRACTILE PROTEIN
Deposited on 2004-07-19, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.161
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aortic preferentially expressed protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Arotic Preferentially Expressed Gene 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2ha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2hA (A:)
    gskapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegg
    lcrlrilaaergdagfytckavneygarqcearlevrge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2hA (A:)
    kapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegglc
    rlrilaaergdagfytckavneygarqcearlevrg