PDB entry 1txb

View 1txb on RCSB PDB site
Description: solution nmr structure of toxin b, a long neurotoxin from the venom of the king cobra, 10 structures
Class: neurotoxin
Keywords: venom, neurotoxin, multigene family, toxin b
Deposited on 1996-07-20, released 1997-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: toxin b
  Species: OPHIOPHAGUS HANNAH [TaxId:8665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01386 (0-72)
  Domains in SCOPe 2.06: d1txba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1txbA (A:)
  tkcyvtpdatsqtcpdgqdicytktwcdgfcssrgkridlgcaatcpkvkpgvdikccst
  dncnpfptwkrkh